Subrahmanya with both consorts
The central form is Sri Subrahmanyaswamy with Valli and Devasena.
Sri Subrahmanyaswamy Devalayam
Kamakotinagar, Padmarao Nagar, Hyderabad District, Telangana, India
A hillock temple in Secunderabad established under Kanchi Kamakoti guidance, with Subrahmanya, Valli and Devasena at the centre of a six-fold worship complex.
Published Timing
6:00 AM-1:00 PM; 4:30 PM-9:00 PM
Hours vary by weekday; all listed evening sessions close at 9:00 PM.
Crowd Planning
Festival peaks
Choose a non-festival morning when flexibility matters.
Best Visit Window
Early day
October to February is generally cooler; Tuesdays, Fridays and major festivals are busier.
Darshan
General queue
Use the currently directed route and authorised counters.
Visitor information: Hours vary by weekday; all listed evening sessions close at 9:00 PM. Current temple directions take priority.
Source: supplied temple research document DT-MU-009-A_TG.docx.
Subrahmanya with Valli and Devasena
Kanchi Paramacharya foundation tradition
Shanmatha worship complex
Sundara Vinayagar first shrine
Overview
Secunderabad temple guide
Skandagiri Temple stands on a small hillock in Padmarao Nagar and is a prominent Subrahmanya centre for Hyderabad and Secunderabad.
The complex follows a Shanmatha presentation with shrines representing Ganesha, Shiva, Subrahmanya, the Goddess, Vishnu and Surya-related worship.
Main Deity and Sacred Form
Temple identity
Regional Telugu-Tamil context
The temple reflects the devotional life of the twin cities and should retain its Telangana identity.
Nijaroopa darshan
The source describes an early period when the deity is seen before daily decoration.
Meaning and Significance
Form, place and tradition
Modern sacred foundation
The site developed from a 1960s devotional committee and Kanchi Paramacharya guidance.
Shanmatha complex
Multiple major Hindu worship streams are represented in one temple.
Popular seventh-abode title
The temple is popularly called a seventh Padai Veedu, without altering the canonical Tamil six.
Sacred Tradition
Narrative presented with clear boundaries
Temple history records a 1961 devotional committee, the choice of the hillock under Kanchi Paramacharya's guidance and foundation work in 1968.
Rahu-Ketu and other temple services belong to local institutional practice. This guide does not diagnose planetary doshas or promise marriage, fertility, health or career outcomes.
History
Literary memory and built fabric
Sacred and literary history
The foundation ceremony took place on 18 May 1968. Sundara Vinayagar was consecrated later that year, and the principal Subrahmanya shrine in January 1970.
Documented fabric
Additional Kamakshi, Ekambareshwarar, Navagraha, Jaya Durga and Varadarajaswamy shrines followed in the 1970s.
Architecture
Source-described spatial character
Hillock setting
The complex is arranged on Skandagiri above Padmarao Nagar.
Colourful gopuram
A sculpted South Indian gateway marks the approach.
Subrahmanya sanctum
The main shrine houses Subrahmanya with Valli and Devasena.
Shanmatha layout
Shrines across six worship streams form a unified complex.
Urban access
Steps and a lift support the final approach.
Incremental development
Major shrines were added between 1968 and 1978.
Special Features
What makes this temple distinct
Subrahmanya with Valli and Devasena
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Kanchi Paramacharya foundation tradition
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Shanmatha worship complex
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Sundara Vinayagar first shrine
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Weekday-specific timings
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Lift for mobility support
A source-described feature of Skandagiri Temple; confirm current visitor access and interpretation locally.
Quick Decision Guide
Choose a visit plan that fits current conditions.
Visit focus
A hillock temple in Secunderabad established under Kanchi Kamakoti guidance, with Subrahmanya, Valli and Devasena at the centre of a six-fold worship complex.
Published schedule
Hours vary by weekday; all listed evening sessions close at 9:00 PM.
Final approach
Urban access through Padmarao Nagar; narrow lanes and limited roadside parking favour cab, auto-rickshaw or public transport
Verify locally
Reconfirm timings, access, photography, offerings and festival controls before travel.
Suggested Visit Sequence
A practical route, not a compulsory pilgrimage order.
1
Use cab, auto or public transport where possible
Current on-site directions always take priority.
2
Take the steps or lift according to mobility
Current on-site directions always take priority.
3
Begin at Sundara Vinayagar
Current on-site directions always take priority.
4
Take darshan of Subrahmanya with both consorts
Current on-site directions always take priority.
5
Visit the Shanmatha shrines in the directed order
Current on-site directions always take priority.
6
Use only official booking channels for temple services
Current on-site directions always take priority.
How to Reach
Urban access through Padmarao Nagar; narrow lanes and limited roadside parking favour cab, auto-rickshaw or public transport
Airport connection
- Rajiv Gandhi International Airport, approximately 35 km
Rail connection
- Secunderabad Junction, approximately 4 km
Road approach
- Urban access through Padmarao Nagar; narrow lanes and limited roadside parking favour cab, auto-rickshaw or public transport
Skandagiri Temple
- Sri Subrahmanyaswamy Devalayam, Skandagiri, Kamakotinagar, Padmarao Nagar, Secunderabad, Hyderabad, Telangana 500061, India
Sacred Timings
Published source schedule; confirm before travel.
Published scheduleHours vary by weekday; all listed evening sessions close at 9:00 PM.Festival and local arrangements may change.
SUNDAY
Sunday
Published time6:00 AM-1:00 PM; 4:30 PM-9:00 PM
MONDAY, WEDNESDAY, THURSDAY
Monday, Wednesday, Thursday
Published time6:00 AM-11:00 AM; 4:30 PM-9:00 PM
TUESDAY
Tuesday
Published time5:30 AM-12:00 PM; 3:00 PM-9:00 PM
FRIDAY AND SATURDAY
Friday and Saturday
Published time6:00 AM-12:00 PM; 4:30 PM-9:00 PM
Schedule note
Confirm before travel
Check the current official schedule, especially on festival, eclipse or special-service days.
Festivals
Temple calendar and regional context
Vaikasi Brahmotsavam
The principal large annual festival.
Skanda Shashti
A six-day festival followed by Devasena Kalyanam.
Thai Poosam
An important anniversary-linked Subrahmanya observance.
Aadi Krittigai
A festival connected with the devotional committee that preceded the temple.
Devotional Practice
One short public Roman formula
Public nama mantra
Om Subrahmanyaya Namah
Meaning: A simple public salutation to Subrahmanya.
Context: This open public formula is optional; no fixed count or guaranteed result is claimed.
Safe personal prayer
Pray briefly for courage, wisdom, ethical action and the welfare of all. Use a safe lamp or a flameless alternative, and avoid initiated formulas or improvised fire rites.
Daily Worship and Rituals
Respectful participation
Join only the public darshan and worship arrangements currently offered by the temple.
Formal archana, abhisheka, homa, kavadi and other vows remain temple-led or guided practices. No piercing, extreme fasting, hazardous carrying or fire rite is presented as compulsory.
No medical, fertility, marriage, exam, prosperity, victory, enemy-destruction or dosha-removal outcome is guaranteed.
Explore Worship & Knowledge
Five focused topics in the Murugan hub.
Offerings and Prasad
Simple, authorised and responsible
Ask before offering
Use only items the temple currently accepts and present them only at authorised points.
Flowers and fruit
Clean flowers, fruit and other modest offerings may be suitable when locally approved.
Responsible devotion
Avoid plastic and food waste. Do not describe offerings, prasada or sacred water as medical treatment.
Best Time to Visit
Season and crowd planning
General planning
October to February is generally cooler; Tuesdays, Fridays and major festivals are busier.
Early visit
An early non-festival visit may be easier, but queues are never guaranteed.
Confirm conditions
Check heat, rain, road, forest, river and festival conditions relevant to this specific temple.
Nearby Sacred Places and Landmarks
Optional extensions, not compulsory stops
Ujjaini Mahakali Temple
Approximately 5 km. A major Secunderabad goddess temple associated with Bonalu.
Open mapHussain Sagar
Approximately 7 km. An urban lake and public landmark between the twin cities.
Open mapBirla Mandir
Approximately 10 km. A hill temple dedicated to Venkateswara.
Open mapJagannath Temple
Approximately 12 km. A Kalinga-style urban temple.
Open mapKarmanghat Hanuman Temple
Approximately 15 km. A historic Hanuman shrine in Hyderabad.
Open mapYadadri
Approximately 70 km. A longer regional pilgrimage extension.
Open mapSecunderabad Sacred Circuit
A suggested sequence that may be reordered.
- Use cab, auto or public transport where possible
- Take the steps or lift according to mobility
- Begin at Sundara Vinayagar
- Take darshan of Subrahmanya with both consorts
- Visit the Shanmatha shrines in the directed order
- Use only official booking channels for temple services
This is not an official compulsory pilgrimage order. Reorder stops according to access, weather, time and mobility.
Visitor Information and Safety
Before you enter
- Temple ruleAllow for narrow lanes and limited parking.
- MobilityDo not treat Rahu-Ketu services as online diagnosis or guaranteed remedy.
- Health boundaryConfirm weekday hours and eclipse-day changes before travel.
- Local conditionsFollow lift capacity and step-safety instructions.
- ClothingWear modest clothing appropriate for an active place of worship.
- FootwearRemove footwear only at the designated point and keep valuables secure.
- Authorised servicesUse authorised counters and official booking channels.
- PhotographyAsk before photography in any worship area.
- Unverified claimsDo not rely on unofficial agents or promised devotional outcomes.
Frequently Asked Questions
Hours vary by weekday; all listed evening sessions close at 9:00 PM. Reconfirm the schedule close to travel because festival and local arrangements may change.
Sri Subrahmanyaswamy Devalayam, Skandagiri, Kamakotinagar, Padmarao Nagar, Secunderabad, Hyderabad, Telangana 500061, India.
Sri Valli Devasena Sameda Sri Subrahmanyaswamy.
The supplied source places it at approximately 500 metres above mean sea level.
Secunderabad Junction, approximately 4 km.
Rajiv Gandhi International Airport, approximately 35 km.
October to February is generally cooler; Tuesdays, Fridays and major festivals are busier.
No. Follow only practices you freely choose and that the temple currently authorises. Guided rites, kavadi, fasting, bathing and paid services are not general admission requirements.
The current rule should be confirmed on arrival. Do not photograph sanctums, worshippers or restricted areas without permission.
No. This guide does not promise medical, fertility, marriage, exam, prosperity, victory, dosha-removal or other guaranteed outcomes.
Reference Notes
Source-led scope and verification boundary
Supplied temple research document - DT-MU-009-A_TG.docx
Primary source read in full for identity, location, timings, travel, tradition, history, architecture, festivals and nearby places.
Official temple information named by the source
Current information should be checked with srisubrahmanyaswamydevalayamskandagiri.org.
Murugan Worship and Knowledge catalogue
Used only for public Roman mantras, safe household devotion, festival framing, regional identity and publication boundaries.